TMEM91 antibody

Name TMEM91 antibody
Supplier Fitzgerald
Catalog 70R-6585
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL
Purity/Format Affinity purified
Blocking Peptide TMEM91 Blocking Peptide
Description Rabbit polyclonal TMEM91 antibody raised against the N terminal of TMEM91
Gene TMEM91
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.