| Name | Tektin 4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3595 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | Tektin 4 Blocking Peptide |
| Description | Rabbit polyclonal Tektin 4 antibody raised against the N terminal of TEKT4 |
| Gene | TEKT4 |
| Supplier Page | Shop |