| Name | NT5M antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2440 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NT5M antibody was raised using the N terminal of NT5M corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL |
| Purity/Format | Affinity purified |
| Blocking Peptide | NT5M Blocking Peptide |
| Description | Rabbit polyclonal NT5M antibody raised against the N terminal of NT5M |
| Gene | NT5M |
| Supplier Page | Shop |