Name | GAN antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4075 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG |
Purity/Format | Affinity purified |
Blocking Peptide | GAN Blocking Peptide |
Description | Rabbit polyclonal GAN antibody raised against the middle region of GAN |
Gene | GAN |
Supplier Page | Shop |