| Name | GAN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4075 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG |
| Purity/Format | Affinity purified |
| Blocking Peptide | GAN Blocking Peptide |
| Description | Rabbit polyclonal GAN antibody raised against the middle region of GAN |
| Gene | GAN |
| Supplier Page | Shop |