| Name | SMPDL3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5357 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | SMPDL3B antibody was raised using the N terminal of SMPDL3B corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF |
| Purity/Format | Affinity purified |
| Blocking Peptide | SMPDL3B Blocking Peptide |
| Description | Rabbit polyclonal SMPDL3B antibody raised against the N terminal of SMPDL3B |
| Gene | SMPDL3B |
| Supplier Page | Shop |