| Name | FKBP2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5298 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV |
| Purity/Format | Affinity purified |
| Blocking Peptide | FKBP2 Blocking Peptide |
| Description | Rabbit polyclonal FKBP2 antibody raised against the N terminal of FKBP2 |
| Gene | FKBP2 |
| Supplier Page | Shop |