| Name | LDHC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2542 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV |
| Purity/Format | Affinity purified |
| Blocking Peptide | LDHC Blocking Peptide |
| Description | Rabbit polyclonal LDHC antibody raised against the middle region of LDHC |
| Gene | LDHC |
| Supplier Page | Shop |