Annexin A8-Like 2 antibody

Name Annexin A8-Like 2 antibody
Supplier Fitzgerald
Catalog 70R-6045
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET
Purity/Format Affinity purified
Blocking Peptide Annexin A8-Like 2 Blocking Peptide
Description Rabbit polyclonal Annexin A8-Like 2 antibody raised against the N terminal of ANXA8L2
Gene ANXA8L1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.