| Name | NPY1R antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5940 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NPY1R antibody was raised using the middle region of NPY1R corresponding to a region with amino acids TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
| Purity/Format | Affinity purified |
| Blocking Peptide | NPY1R Blocking Peptide |
| Description | Rabbit polyclonal NPY1R antibody raised against the middle region of NPY1R |
| Gene | NPY1R |
| Supplier Page | Shop |