| Name | DDX1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4784 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGA |
| Purity/Format | Affinity purified |
| Blocking Peptide | DDX1 Blocking Peptide |
| Description | Rabbit polyclonal DDX1 antibody |
| Gene | DDX1 |
| Supplier Page | Shop |