| Name | PON1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5362 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA |
| Purity/Format | Affinity purified |
| Blocking Peptide | PON1 Blocking Peptide |
| Description | Rabbit polyclonal PON1 antibody raised against the C terminal of PON1 |
| Gene | PON1 |
| Supplier Page | Shop |