VARS antibody

Name VARS antibody
Supplier Fitzgerald
Catalog 70R-3183
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP
Purity/Format Affinity purified
Blocking Peptide VARS Blocking Peptide
Description Rabbit polyclonal VARS antibody raised against the middle region of VARS
Gene VARS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.