| Name | NR1I3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1002 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | NR1I3 antibody was raised using the N terminal of NR1I3 corresponding to a region with amino acids MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | NR1I3 Blocking Peptide |
| Description | Rabbit polyclonal NR1I3 antibody raised against the N terminal of NR1I3 |
| Gene | NR1I3 |
| Supplier Page | Shop |