| Name | P2RXL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5077 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | P2RXL1 antibody was raised using the N terminal of P2RXL1 corresponding to a region with amino acids NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV |
| Purity/Format | Affinity purified |
| Blocking Peptide | P2RXL1 Blocking Peptide |
| Description | Rabbit polyclonal P2RXL1 antibody raised against the N terminal of P2RXL1 |
| Gene | P2RX6 |
| Supplier Page | Shop |