| Name | HSPA6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3829 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV |
| Purity/Format | Affinity purified |
| Blocking Peptide | HSPA6 Blocking Peptide |
| Description | Rabbit polyclonal HSPA6 antibody |
| Gene | HSPA4 |
| Supplier Page | Shop |