| Name | GART antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4053 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GART antibody was raised using the middle region of GART corresponding to a region with amino acids VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV |
| Purity/Format | Affinity purified |
| Blocking Peptide | GART Blocking Peptide |
| Description | Rabbit polyclonal GART antibody raised against the middle region of GART |
| Gene | GART |
| Supplier Page | Shop |