| Name | AS3MT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4474 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | AS3MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | AS3MT Blocking Peptide |
| Description | Rabbit polyclonal AS3MT antibody |
| Gene | AS3MT |
| Supplier Page | Shop |