Lipocalin 8 antibody

• Supplier: Fitzgerald
• Catalog: 70R-3225
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Lipocalin 8 antibody was raised using the N terminal of LCN8 corresponding to a region with amino acids EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN
• Purity/Format: Affinity purified
• Blocking Peptide: Lipocalin 8 Blocking Peptide
• Description: Rabbit polyclonal Lipocalin 8 antibody raised against the N terminal of LCN8
• Gene: LCN8