EHD4 antibody

Name EHD4 antibody
Supplier Fitzgerald
Catalog 70R-2680
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT
Purity/Format Affinity purified
Blocking Peptide EHD4 Blocking Peptide
Description Rabbit polyclonal EHD4 antibody raised against the middle region of EHD4
Gene EHD4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.