| Name | GLOD4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3898 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG |
| Purity/Format | Affinity purified |
| Blocking Peptide | GLOD4 Blocking Peptide |
| Description | Rabbit polyclonal GLOD4 antibody raised against the middle region of GLOD4 |
| Gene | GLOD4 |
| Supplier Page | Shop |