| Name | WDR33 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6953 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | WDR33 antibody was raised using the middle region of WDR33 corresponding to a region with amino acids TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL |
| Purity/Format | Affinity purified |
| Blocking Peptide | WDR33 Blocking Peptide |
| Description | Rabbit polyclonal WDR33 antibody raised against the middle region of WDR33 |
| Gene | WDR33 |
| Supplier Page | Shop |