ACTRT1 antibody

Name ACTRT1 antibody
Supplier Fitzgerald
Catalog 70R-3289
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
Purity/Format Affinity purified
Blocking Peptide ACTRT1 Blocking Peptide
Description Rabbit polyclonal ACTRT1 antibody raised against the middle region of ACTRT1
Gene ACTRT1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.