Name | LRRC57 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4255 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | LRRC57 antibody was raised using the middle region of LRRC57 corresponding to a region with amino acids NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL |
Purity/Format | Affinity purified |
Blocking Peptide | LRRC57 Blocking Peptide |
Description | Rabbit polyclonal LRRC57 antibody raised against the middle region of LRRC57 |
Gene | LRRC57 |
Supplier Page | Shop |