| Name | ZFYVE27 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1729 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | ZFYVE27 antibody was raised using the middle region of ZFYVE27 corresponding to a region with amino acids VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ZFYVE27 Blocking Peptide |
| Description | Rabbit polyclonal ZFYVE27 antibody raised against the middle region of ZFYVE27 |
| Gene | ZFYVE27 |
| Supplier Page | Shop |