| Name | C2ORF47 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4100 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C2ORF47 antibody was raised using the middle region of C2Orf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | C2ORF47 Blocking Peptide |
| Description | Rabbit polyclonal C2ORF47 antibody raised against the middle region of C2Orf47 |
| Gene | C2orf47 |
| Supplier Page | Shop |