| Name | KCTD10 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1503 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KCTD10 Blocking Peptide |
| Description | Rabbit polyclonal KCTD10 antibody raised against the N terminal of KCTD10 |
| Gene | KCTD10 |
| Supplier Page | Shop |