Name | KCTD10 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1503 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog |
Antigen | KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | KCTD10 Blocking Peptide |
Description | Rabbit polyclonal KCTD10 antibody raised against the N terminal of KCTD10 |
Gene | KCTD10 |
Supplier Page | Shop |