| Name | SLC16A8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1793 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | SLC16A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC16A8 Blocking Peptide |
| Description | Rabbit polyclonal SLC16A8 antibody |
| Gene | SLC16A8 |
| Supplier Page | Shop |