| Name | RBPMS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4900 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RBPMS antibody was raised using the middle region of RBPMS corresponding to a region with amino acids PASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBPMS Blocking Peptide |
| Description | Rabbit polyclonal RBPMS antibody raised against the middle region of RBPMS |
| Gene | RBPMS |
| Supplier Page | Shop |