| Name | KIF13B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5670 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KIF13B antibody was raised using the N terminal of KIF13B corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIF13B Blocking Peptide |
| Description | Rabbit polyclonal KIF13B antibody raised against the N terminal of KIF13B |
| Gene | KIF13B |
| Supplier Page | Shop |