Name | KIF13B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5670 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | KIF13B antibody was raised using the N terminal of KIF13B corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE |
Purity/Format | Affinity purified |
Blocking Peptide | KIF13B Blocking Peptide |
Description | Rabbit polyclonal KIF13B antibody raised against the N terminal of KIF13B |
Gene | KIF13B |
Supplier Page | Shop |