CHRNA3 antibody

Name CHRNA3 antibody
Supplier Fitzgerald
Catalog 70R-5188
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN
Purity/Format Affinity purified
Blocking Peptide CHRNA3 Blocking Peptide
Description Rabbit polyclonal CHRNA3 antibody raised against the N terminal of CHRNA3
Gene CHRNA3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.