HLA-DQA2 antibody

• Supplier: Fitzgerald
• Catalog: 70R-4489
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: HLA-DQA2 antibody was raised using the middle region of HLA-DQA2 corresponding to a region with amino acids LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
• Purity/Format: Affinity purified
• Blocking Peptide: HLA-DQA2 Blocking Peptide
• Description: Rabbit polyclonal HLA-DQA2 antibody raised against the middle region of HLA-DQA2
• Gene: HLA-DQA2