DUSP19 antibody

Name DUSP19 antibody
Supplier Fitzgerald
Catalog 70R-4137
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Purity/Format Affinity purified
Blocking Peptide DUSP19 Blocking Peptide
Description Rabbit polyclonal DUSP19 antibody raised against the C terminal of DUSP19
Gene DUSP19
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.