Name | RPL3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4713 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY |
Purity/Format | Affinity purified |
Blocking Peptide | RPL3 Blocking Peptide |
Description | Rabbit polyclonal RPL3 antibody raised against the C terminal of RPL3 |
Gene | RPL3 |
Supplier Page | Shop |