RPL3 antibody

Name RPL3 antibody
Supplier Fitzgerald
Catalog 70R-4713
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY
Purity/Format Affinity purified
Blocking Peptide RPL3 Blocking Peptide
Description Rabbit polyclonal RPL3 antibody raised against the C terminal of RPL3
Gene RPL3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.