| Name | GLA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5451 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | GLA antibody was raised using the N terminal of GLA corresponding to a region with amino acids PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF |
| Purity/Format | Affinity purified |
| Blocking Peptide | GLA Blocking Peptide |
| Description | Rabbit polyclonal GLA antibody raised against the N terminal of GLA |
| Gene | GLA |
| Supplier Page | Shop |