CHRNA7 antibody

• Supplier: Fitzgerald
• Catalog: 70R-1540
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: CHRNA7 Blocking Peptide
• Description: Rabbit polyclonal CHRNA7 antibody raised against the middle region of CHRNA7
• Gene: CHRFAM7A