| Name | MORF4L1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1284 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | MORF4L1 antibody was raised using the middle region of MORF4L1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MORF4L1 Blocking Peptide |
| Description | Rabbit polyclonal MORF4L1 antibody raised against the middle region of MORF4L1 |
| Gene | MORF4L1 |
| Supplier Page | Shop |