| Name | SH3BP4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3657 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SH3BP4 antibody was raised using the N terminal of SH3BP4 corresponding to a region with amino acids FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS |
| Purity/Format | Affinity purified |
| Blocking Peptide | SH3BP4 Blocking Peptide |
| Description | Rabbit polyclonal SH3BP4 antibody raised against the N terminal of SH3BP4 |
| Gene | ZFP36 |
| Supplier Page | Shop |