METTL1 antibody

Name METTL1 antibody
Supplier Fitzgerald
Catalog 70R-1155
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
Purity/Format Total IgG Protein A purified
Blocking Peptide METTL1 Blocking Peptide
Description Rabbit polyclonal METTL1 antibody raised against the middle region of METTL1
Gene METTL1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.