| Name | ENPP6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5392 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS |
| Purity/Format | Affinity purified |
| Blocking Peptide | ENPP6 Blocking Peptide |
| Description | Rabbit polyclonal ENPP6 antibody raised against the middle region of ENPP6 |
| Gene | ENPP6 |
| Supplier Page | Shop |