| Name | FETUB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5424 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL |
| Purity/Format | Affinity purified |
| Blocking Peptide | FETUB Blocking Peptide |
| Description | Rabbit polyclonal FETUB antibody raised against the N terminal of FETUB |
| Gene | FETUB |
| Supplier Page | Shop |