| Name | SH3BGR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1963 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SH3BGR antibody was raised using the N terminal of SH3BGR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV |
| Purity/Format | Affinity purified |
| Blocking Peptide | SH3BGR Blocking Peptide |
| Description | Rabbit polyclonal SH3BGR antibody raised against the N terminal of SH3BGR |
| Gene | SH3BGR |
| Supplier Page | Shop |