SH3BGR antibody

Name SH3BGR antibody
Supplier Fitzgerald
Catalog 70R-1963
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SH3BGR antibody was raised using the N terminal of SH3BGR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV
Purity/Format Affinity purified
Blocking Peptide SH3BGR Blocking Peptide
Description Rabbit polyclonal SH3BGR antibody raised against the N terminal of SH3BGR
Gene SH3BGR
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.