| Name | C10ORF132 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4206 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C10ORF132 antibody was raised using the N terminal Of C10Orf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | C10ORF132 Blocking Peptide |
| Description | Rabbit polyclonal C10ORF132 antibody raised against the N terminal Of C10Orf132 |
| Gene | GOLGA7B |
| Supplier Page | Shop |