| Name | LDHD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3502 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV |
| Purity/Format | Affinity purified |
| Blocking Peptide | LDHD Blocking Peptide |
| Description | Rabbit polyclonal LDHD antibody raised against the middle region of LDHD |
| Gene | LDHD |
| Supplier Page | Shop |