| Name | ApoA-IV antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5429 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ApoA-IV antibody was raised using the C terminal of APOA4 corresponding to a region with amino acids RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | ApoA-IV Blocking Peptide |
| Description | Rabbit polyclonal ApoA-IV antibody raised against the C terminal of APOA4 |
| Gene | APOA4 |
| Supplier Page | Shop |