| Name | REG1B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5333 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | REG1B antibody was raised using the N terminal of REG1B corresponding to a region with amino acids MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYF |
| Purity/Format | Affinity purified |
| Blocking Peptide | REG1B Blocking Peptide |
| Description | Rabbit polyclonal REG1B antibody raised against the N terminal of REG1B |
| Gene | REG1B |
| Supplier Page | Shop |