| Name | FAM129A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1294 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM129A antibody was raised using the N terminal of FAM129A corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FAM129A Blocking Peptide |
| Description | Rabbit polyclonal FAM129A antibody raised against the N terminal of FAM129A |
| Gene | FAM129A |
| Supplier Page | Shop |