| Name | PAICS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3667 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PAICS antibody was raised using the N terminal of PAICS corresponding to a region with amino acids ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | PAICS Blocking Peptide |
| Description | Rabbit polyclonal PAICS antibody raised against the N terminal of PAICS |
| Gene | PAICS |
| Supplier Page | Shop |