| Name | ASS1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1133 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ASS1 Blocking Peptide |
| Description | Rabbit polyclonal ASS antibody raised against the N terminal Of Ass |
| Gene | ASS1 |
| Supplier Page | Shop |