| Name | HSPC111 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3260 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR |
| Purity/Format | Affinity purified |
| Blocking Peptide | HSPC111 Blocking Peptide |
| Description | Rabbit polyclonal HSPC111 antibody raised against the middle region of HSPC111 |
| Gene | NOP16 |
| Supplier Page | Shop |