| Name | WDR49 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3997 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WDR49 antibody was raised using the N terminal of WDR49 corresponding to a region with amino acids SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLY |
| Purity/Format | Affinity purified |
| Blocking Peptide | WDR49 Blocking Peptide |
| Description | Rabbit polyclonal WDR49 antibody raised against the N terminal of WDR49 |
| Gene | WDR49 |
| Supplier Page | Shop |